CDS

Accession Number TCMCG083C11312
gbkey CDS
Protein Id KMZ67212.1
Location complement(join(122233..122290,122382..122455,122541..122707,122799..122868,122957..123088))
Organism Zostera marina
locus_tag ZOSMA_271G00100

Protein

Length 166aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA41721, BioSample:SAMN00991190
db_source LFYR01000918.1
Definition putative Mediator of RNA polymerase II transcription subunit [Zostera marina]
Locus_tag ZOSMA_271G00100

EGGNOG-MAPPER Annotation

COG_category K
Description Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko03021        [VIEW IN KEGG]
KEGG_ko ko:K15148        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0000122        [VIEW IN EMBL-EBI]
GO:0000428        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005654        [VIEW IN EMBL-EBI]
GO:0005667        [VIEW IN EMBL-EBI]
GO:0006355        [VIEW IN EMBL-EBI]
GO:0006357        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009889        [VIEW IN EMBL-EBI]
GO:0009890        [VIEW IN EMBL-EBI]
GO:0009892        [VIEW IN EMBL-EBI]
GO:0010468        [VIEW IN EMBL-EBI]
GO:0010556        [VIEW IN EMBL-EBI]
GO:0010558        [VIEW IN EMBL-EBI]
GO:0010605        [VIEW IN EMBL-EBI]
GO:0010629        [VIEW IN EMBL-EBI]
GO:0016591        [VIEW IN EMBL-EBI]
GO:0016592        [VIEW IN EMBL-EBI]
GO:0019219        [VIEW IN EMBL-EBI]
GO:0019222        [VIEW IN EMBL-EBI]
GO:0030880        [VIEW IN EMBL-EBI]
GO:0031323        [VIEW IN EMBL-EBI]
GO:0031324        [VIEW IN EMBL-EBI]
GO:0031326        [VIEW IN EMBL-EBI]
GO:0031327        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031981        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044451        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0044798        [VIEW IN EMBL-EBI]
GO:0045892        [VIEW IN EMBL-EBI]
GO:0045934        [VIEW IN EMBL-EBI]
GO:0048519        [VIEW IN EMBL-EBI]
GO:0048523        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0050794        [VIEW IN EMBL-EBI]
GO:0051171        [VIEW IN EMBL-EBI]
GO:0051172        [VIEW IN EMBL-EBI]
GO:0051252        [VIEW IN EMBL-EBI]
GO:0051253        [VIEW IN EMBL-EBI]
GO:0055029        [VIEW IN EMBL-EBI]
GO:0060255        [VIEW IN EMBL-EBI]
GO:0061695        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0070847        [VIEW IN EMBL-EBI]
GO:0080090        [VIEW IN EMBL-EBI]
GO:0090575        [VIEW IN EMBL-EBI]
GO:1902494        [VIEW IN EMBL-EBI]
GO:1902679        [VIEW IN EMBL-EBI]
GO:1903506        [VIEW IN EMBL-EBI]
GO:1903507        [VIEW IN EMBL-EBI]
GO:1990234        [VIEW IN EMBL-EBI]
GO:2000112        [VIEW IN EMBL-EBI]
GO:2000113        [VIEW IN EMBL-EBI]
GO:2001141        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGTCGACATCAGCAGCATATCCTCCACCGCCTCCGTTCTATAAACTGTACAAAGATGCCAAATCAGGGCCAGATCCGCCACCTCCACTACCAAAGGGGGCGACATACACTCTTTTTGGCGCCACTTACACTACAGATGATGTTCTCCCAAGCTTGGAAGAACAGGGAGTTCGACAACTTTACCCAAAAGATTCTAACATAGATTACAAAAAGGAGTTGAGAGCCCTGAATCGAGACCTCCAGCTAAATTTCTTAGAATTGGCAGATGTTCTTGTTGAGAGGCCCTCCCAATATGCGCAACGAATTGAAGAAATCTCTACCATCTTTAAGAATATGCATCACCTTCTCAATTGTCTTCGACCACTCCAGGCTCAGGCTACATTGATTCATCTTCTAGAGCTTCAAATCGAACGTCGCAAGCAAGCCATCGAGGACATCAAAATGAGAAGAAAAGAAGCTCAGAGAATGCTCAAGGAAGCCATGGAGATGCTTGATGGCTAA
Protein:  
MSTSAAYPPPPPFYKLYKDAKSGPDPPPPLPKGATYTLFGATYTTDDVLPSLEEQGVRQLYPKDSNIDYKKELRALNRDLQLNFLELADVLVERPSQYAQRIEEISTIFKNMHHLLNCLRPLQAQATLIHLLELQIERRKQAIEDIKMRRKEAQRMLKEAMEMLDG